PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 362aa    MW: 41303.2 Da    PI: 7.1791
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598410.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
   XP_009598410.1 14 KGLWSPEEDEKLCNYITKFGVGSWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding43.48.1e-1471110546
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++E+++++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
   XP_009598410.1  71 SQDEEDRIISLHQVLGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                      89****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24664IPR009057Homeodomain-like
PROSITE profilePS5129424.444965IPR017930Myb domain
SuperFamilySSF466896.74E-2912108IPR009057Homeodomain-like
SMARTSM007171.1E-111363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
CDDcd001671.00E-91761No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2365117IPR009057Homeodomain-like
SMARTSM007171.0E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129417.41866116IPR017930Myb domain
CDDcd001671.13E-871112No hitNo description
PfamPF002493.4E-1271110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRHSCCVKQ KLRKGLWSPE EDEKLCNYIT KFGVGSWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMV SQDEEDRIIS LHQVLGNRWA QIAAQLPGRT DNEIKNFWNS SLKKKLIKQG  120
IDPNTHKPLN ENQVKDEENC RNKTSMLQIP HLIELPSAEL VDQPFHLSNR SFNSEVNGQL  180
TEASKDQFVS KQVFDLLFIH EFQANVNPSG YNSEILAQYQ QNMRPNDNRQ REFQGNTNYG  240
FGSETSLTKL KHGQTTETDF ASSSTSRLSS SNSSNICSYQ NTAGIRMTRM LENSEDLSWE  300
VDNKIESLFQ YPCVGIKNEE LKSSPRQERE LYGHSSGDFM SNPLSSLTEE FSGATLDVFQ  360
QI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
1h8a_C4e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754426e-57HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598410.10.0PREDICTED: transcription factor MYB32-like
TrEMBLM1BJE11e-166M1BJE1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000466451e-165(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-78myb domain protein 86